REV-ERB agonist raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
Reviewed 2025-12-16. Anything still debated is marked as such rather than presented as settled.
Preclinical reports have linked SR9009 to improved endurance and altered energy expenditure in rodents. Such findings have prompted interest in whether REV-ERB activation can influence skeletal muscle metabolism. However, the reported effects depend on dose, route, and experimental model, and replication across laboratories is limited. Human trials have not established comparable outcomes, so claims about exercise performance remain speculative. The absence of controlled human data is a central limitation in interpreting these observations.
The mechanism of action involves binding to REV-ERB receptors and recruiting corepressor complexes, which represses target gene transcription. This contrasts with many nuclear receptor agonists that activate transcription. Downstream effects may include changes in autophagy, mitochondrial biogenesis, and lipid handling, but the precise pathways remain an active area of study. Whether these molecular events translate into meaningful physiological effects in humans is unresolved. Most evidence comes from cultured cells and rodent models rather than human participants.
SR9009 is a synthetic small molecule studied as an agonist of the nuclear receptors REV-ERBα and REV-ERBβ. It is not a steroid, peptide, or natural hormone. In scientific literature, it appears under the code SR9009 and in non-scientific contexts as Stenabolic. The compound was identified through chemical screening efforts aimed at targeting circadian clock components. Its status remains investigational, and no regulatory agency has approved it as a human medicine.
REV-ERB proteins help regulate daily cycles in gene expression, including genes tied to lipid and glucose metabolism. SR9009 binds these receptors and alters their activity in cell and animal experiments. Consequences observed in rodents include changes in skeletal muscle oxidative capacity, blood lipid levels, and exercise performance. The precise chain from receptor occupancy to whole-body effects is still an active area of study. Human responses cannot be assumed from rodent data.
Most published work on SR9009 consists of preclinical studies. It is widely sold as a research chemical, a category that does not imply safety, efficacy, or pharmaceutical-grade quality. Sports anti-doping organizations have listed SR9009 as a prohibited substance, and its presence in an athlete sample can lead to sanctions. Legal status differs by country; in several jurisdictions it is not approved for human consumption and may be treated as an unapproved new drug.
| Property | Value | Notes |
|---|---|---|
| Chemical class | Synthetic REV-ERB agonist | Small molecule; not a steroid or peptide. |
| Primary targets | NR1D1 and NR1D2 | Also known as REV-ERBα and REV-ERBβ. |
| Studied routes | Intraperitoneal in rodents | Oral bioavailability in humans is not established. |
| Human approval | No approved therapeutic indication | No recognized clinical use. |
| Key uncertainty | Human physiological effects | Preclinical findings may not translate. |
Regulatory agencies have not approved SR9009 for human therapeutic use. It is typically sold as a research chemical with labels stating that it is not for human consumption. The World Anti-Doping Agency prohibits the substance in sport, generally under the category of non-approved substances. Customs and national laws may restrict importation, sale, or possession. Product quality and legal status can vary by country and vendor, and therapeutic claims are not permitted in regulated advertising because the compound lacks approval.
Several misconceptions surround SR9009. It is often described as a SARM, a steroid, or an exercise pill, but its known target is the REV-ERB receptor family. Rodent studies have examined exercise capacity and metabolic markers, yet human outcomes remain unproven. Oral bioavailability appears low in animals, and human pharmacokinetics are not well characterized. Online products may contain impurities or different compounds, so identity and purity testing are important for research use.
Analytical chemists detect SR9009 with liquid chromatography-tandem mass spectrometry, commonly abbreviated LC-MS/MS. Sample preparation may involve protein precipitation, liquid-liquid extraction, or solid-phase extraction before analysis. Laboratories can target the parent compound or its metabolites, depending on the matrix and the purpose of testing. Anti-doping methods require sensitive and specific assays because concentrations in biological samples can be low. Reference standards and validated methods are essential for reliable identification and quantification.
Following the guidelines of the European institutions, the "adjustment" policy was accompanied by the introduction of three important "structural reforms": the Labor Reform of September 2010 with the purpose of making it more "flexible"; the new law on pensions approved in June 2011 which raised the retirement age from 65 to 67; and the Royal Decree Law, also of June 2011, which "made more flexible" the collective bargaining system. It also raised the general VAT rate from 16 to 18%. The turn in economic policy caused the government to break with the unions who called a general strike for September 29, 2010, the first since Zapatero was in power. Despite all the measures adopted by the government, the risk premium on Spanish debt continued to rise and in the summer of 2011 the situation became unsustainable. Then the European Central Bank decided to act by buying Spanish public debt – and that of other countries with problems, such as Italy— but in exchange it demanded new "structural reforms". The response of Rodríguez Zapatero's government was to proceed quickly with the reform of Article 135 of the Constitution, in which it had the immediate support of the People's Party, to establish the commitment of the State and the autonomous communities not to "incur a structural deficit that exceeds the margins established, where appropriate, by the European Union for its Member States".
==== Wound healing ==== Nanogels are a promising technology being explored to aid in the wound healing process. Given their ability to encapsulate various types of cargo, nanogels can strategically deliver anti-inflammatory agents, antimicrobial drugs, and necessary growth factors to facilitate new tissue growth and blood vessel formation. Chitosan-based nanogels have demonstrated an improved wound healing effect in previous studies. Chitosan-based nanogels encapsulating interleukin-2 were successfully used to stimulate the immune system and advance the wound healing process. Additionally, chitosan-based nanogels carrying an antibiotic, silver sulfadiazine, were found to decrease the size of second-degree burns in one in vivo study. In another study, silver-loaded nanogels were synthesized in a natural polymer-based solution containing aloe vera, and the presence of aloe vera led to increased healing and a decrease in wound size. With the goal of preventing infection and accelerating the healing process, one group has also published a new nanogel design consisting of an encapsulating core and a functionalized outer surface capable of targeting bacteria present in wounds.
== Sources == Niacin is found in a variety of whole and processed foods, including fortified packaged foods, meat from various animal sources, seafoods, and spices. In general, animal-sourced foods provide about 5–10 mg niacin per serving, although dairy foods and eggs have little. Some plant-sourced foods such as nuts, legumes and grains provide about 2–5 mg niacin per serving, although in some grain products this naturally present niacin is largely bound to polysaccharides and glycopeptides, making it only about 30% bioavailable. Fortified food ingredients such as wheat flour have niacin added, which is bioavailable. Among whole food sources with the highest niacin content per 100 grams:
Sources: en.wikipedia.org
Hitler's aspirations to hegemony over Europe and the establishment of the New Order, already evident from architectural and decorative features of the new Chancellery, are even more clearly expressed here. External symbols suggest that the domed hall was where Hitler as cosmocrat (Herr der Welt) would appear before his Herrenvolk: On top of the dome's lantern was the German heraldic eagle clutching the globe of the Earth (Erdball). This symbolism was well known in imperial Roman iconography, for example, the restored statue of Claudius holding a ball and eagle in his right hand. The vast dome, on which it rested, as with Hadrian's Pantheon, symbolically represented the vault of the sky spanning Germany's empire. The globe on the dome's lantern was enhanced and emphasised by two monumental sculptures by Breker, each 15 metres tall, which flanked the north façade of the building: at its west end Atlas supporting the heavens, at its east end Tellus supporting the Earth. Both mythological figures were chosen by Hitler himself. Giesler says that Speer was wrong to represent the Volkshalle as a symbol of World Domination (Weltherrschaft). Speer in his 1971 Playboy magazine interview states:
===== Replacement ===== Some ingredients originating from endangered or otherwise rare species have widely (but not universally) recognized alternatives. For example, rhinoceros horn is generally replaced with a buffalo horn "concentrate powder", a practice adopted by the Chinese Pharmacopoeia. Tiger bone has been replaced with a mixture of bone powders from three livestock species in a Chinese patent medicine approved as a prescription drug in China. More
The empire's geographic and maritime advantages reduced the costs of transporting goods and facilitated trade, making it a key driver of economic growth from antiquity and through the post-classical period. Infrastructure, including roads, public buildings, and the legal system, supported trade and other economic activities. Regions like Asia Minor, the Aegean islands, Egypt, the Levant, and Africa thrived as mature economic centres despite political challenges and military insecurities. From the mid-6th century onward, plagues, invasions, and wars caused populations and economies to decline, leading to the collapse of the ancient economy. Major cities like Constantinople, Antioch, Alexandria, and Thessaloniki continued to support substantial populations exceeding 100,000, while the countryside transitioned into fortified settlements. These rural areas developed into hamlets and villages, reflecting an economic shift between historical periods towards more efficient land use. Low population density prompted emperors to encourage migration and resettlement, stimulating agriculture and demographic growth. By the 9th century, the economy began to revive, marked by increased agricultural production and urban expansion. Advances in science, technical knowledge, and literacy gave the empire a competitive edge over its neighbours. The 11th and 12th centuries witnessed consistent and rapid population growth, marking the peak of this revival.
The alkali metals are more similar to each other than the elements in any other group are to each other. Indeed, the similarity is so great that it is quite difficult to separate potassium, rubidium, and caesium, due to their similar ionic radii; lithium and sodium are more distinct. For instance, when moving down the table, all known alkali metals show increasing atomic radius, decreasing electronegativity, increasing reactivity, and decreasing melting and boiling points as well as heats of fusion and vaporisation. In general, their densities increase when moving down the table, with the exception that potassium is less dense than sodium. One of the very few properties of the alkali metals that does not display a very smooth trend is their reduction potentials: lithium's value is anomalous, being more negative than the others. This is because the Li+ ion has a very high hydration energy in the gas phase: though the lithium ion disrupts the structure of water significantly, causing a higher change in entropy, this high hydration energy is enough to make the reduction potentials indicate it as being the most electropositive alkali metal, despite the difficulty of ionising it in the gas phase. The stable alkali metals are all silver-coloured metals except for caesium, which has a pale golden tint: it is one of only three metals that are clearly coloured (the other two being copper and gold).
Sources: en.wikipedia.org
== Synthesis == ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
==== Suggestibility ==== While research from the 1960s indicated increased suggestibility under the influence of LSD among both mentally ill and healthy individuals, the CIA and US Department of Defense conducted secret mind control experiments in which LSD was administered to unwitting human subjects as part of secret operations MKUltra and Operation Midnight Climax.
Asymmetric Catalysis: Wennemers led the development of tripeptides containing H-Pro-Pro-Xaa type sequences (Pro: proline, Xaa: any amine) as organocatalysts for C–C bond formations based on an enamine mechanism. High reactivity, stereo- and chemoselectivity for aldol or conjugate addition reactions can be achieved by varying the absolute configuration of the single amino acids as well as the functional group of the Xaa residue. The modularity of the peptides enabled creation of catalysts capable of catalyzing the conjugate addition reactions of aldehydes to nitroolefins with as little as 0.05 mol% of tripeptidic catalyst. She also worked on other organocatalyzed transformations. Inspired by natural polyketide synthases—which use malonic acid half thioesters (MAHTs) as thioester enolate equivalents — she developed organocatalytic methods for stereoselective addition reactions of MAHTs (and protected variants monothiomalonates, MTMs) to electrophiles using cinchona alkaloid derived catalysts. The introduction of fluorinated MAHTs and MTMs allowed for the stereoselective introduction of fluorine substituents in fluoroacetate aldol reactions as well as further addition reactions to imines and nitroolefins.
In the first mechanism, Browner M.F. and colleagues proposed the base-catalysis mechanism, carried out by the conserved glutamate residue and the Zn2+ ion. In the second mechanism, the Matthews-mechanism, Kester and Matthews suggested an interaction between a water molecule and the Zn2+ ion during the acid-base catalysis. In the third mechanism, the Manzetti-mechanism, Manzetti Sergio and colleagues provided evidence that a coordination between water and zinc during catalysis was unlikely, and suggested a third mechanism wherein a histidine from the HExxHxxGxxH-motif participates in catalysis by allowing the Zn2+ ion to assume a quasi-penta coordinated state, via its dissociation from it. In this state, the Zn2+ ion is coordinated with the two oxygen atoms from the catalytic glutamic acid, the substrate's carbonyl oxygen atom, and the two histidine residues, and can polarize the glutamic acid's oxygen atom, proximate the scissile bond, and induce it to act as reversible electron donor. This forms an oxyanion transition state. At this stage, a water molecule acts on the dissociated scissile bond and completes the hydrolyzation of the substrate.
Feduccia's frill argument was followed up in several other publications, in which researchers interpreted the filamentous impressions around Sinosauropteryx fossils as remains of collagen fibres rather than primitive feathers. Since the structures are clearly external to the body, these researchers have proposed that the fibres formed a frill on the back of the animal and underside of its tail, similar to some modern aquatic lizards. The absence of feathers would refute the proposal that Sinosauropteryx is the most basal known theropod genus with feathers, and also raise questions about the current theory of feather origins itself. It calls into question the idea that the first feathers evolved not for flight but for insulation, and that they made their first appearance in relatively basal dinosaur lineages that later evolved into modern birds. Most researchers have disagreed with the identification of the structures as collagen or other structural fibres. Notably, the team of scientists that reported the presence of pigmentation cells in the structures argued that their presence proved the structures were feathers, not collagen, because collagen does not contain pigment. Gregory S. Paul reidentified what the collagen hypothesis's proponents consider a body outline outside of the fibres as an artefact of preparation: breakage and brushed-on sealant have been misidentified as the outline of the body. The hypothesis that the structures were collagen fibers was closely analyzed and disproven by a 2017 paper published by Smithwick et al.
Sources: en.wikipedia.org
It is a synthetic compound that acts as an agonist at REV-ERBα and REV-ERBβ. It is used mainly as a research chemical to study circadian and metabolic pathways. It is not approved for human therapeutic use.
REV-ERB receptors generally repress transcription when bound by natural heme. SR9009 is described as an agonist that enhances this repressive activity. The result is altered expression of clock and metabolic genes.
Published controlled human trials are lacking. Some sources cite limited or unofficial reports, but these do not establish safety or efficacy. Claims about human performance effects remain unverified.
It is a synthetic compound studied as an agonist of REV-ERB nuclear receptors. It is not an approved medicine and has mainly been examined in laboratory and animal research.