If you have been reading about REV-ERB agonist and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Last reviewed on 2026-07-02. Where a claim depends on a specific study, the study is described rather than over-claimed.
Identity and purity of SR9009 samples are usually checked with chromatographic and spectrometric methods. High-performance liquid chromatography can separate the compound from related impurities, while mass spectrometry provides molecular mass confirmation. Nuclear magnetic resonance spectroscopy may be used for structural verification in research settings. No single method proves biological activity, and certificates of analysis should be reviewed alongside raw data. Independent testing is often needed because online products vary widely.
SR9009 stability depends on temperature, moisture, light, and solvent. Solid material is generally kept cool and dry, while solutions may require protection from repeated warming and cooling. Degradation can appear as color changes, precipitate, or new chromatographic peaks. Researchers should follow supplier instructions and their own stability data. Long-term storage conditions for human use have not been established because the compound lacks approved clinical formulation.
Scientific discussion of SR9009 often separates animal evidence from human anecdote. Rodent studies provide controlled data on endurance, metabolism, and gene expression, but they use specific strains, doses, and treatment durations. Human reports are mostly uncontrolled and cannot establish cause and effect. Open questions include oral bioavailability, tissue distribution, metabolic stability, and long-term effects. Review articles generally call for more rigorous pharmacokinetic and safety research before any clinical use could be considered.
Analytical methods for SR9009 typically rely on liquid chromatography coupled with tandem mass spectrometry. The technique can separate the parent compound from related substances and detect low concentrations in biological matrices. Urine and blood are common samples in anti-doping testing, while in vitro studies may use cell culture media. Rapid metabolism and low expected concentrations make method validation important for reliable identification. Exact metabolite patterns can vary by species and are not fully mapped.
Regulatory treatment of SR9009 reflects its investigational status. The compound has no approved human therapeutic indication, and sports authorities prohibit its use. It appears on anti-doping lists as a non-approved substance or metabolic modulator, depending on the list version. Products sold online as research chemicals are not quality-controlled medicines, so their identity and purity can differ from the label. Such products may also contain unlisted compounds, which complicates both testing and safety assessment.
| Property | Value | Notes |
|---|---|---|
| Synonyms | SR9009; Stenabolic | Stenabolic is an informal name |
| Common form | Crystalline powder | Supplied in milligram to gram quantities |
| Long-term storage | -20 °C, desiccated, protected from light | Reduces degradation |
| Detection technique | LC-MS/MS | Common in anti-doping and research analysis |
| Regulatory status | Prohibited in sport by WADA | Not approved for human therapeutic use |
Research interest in SR9009 grew from studies of circadian biology and metabolic disease. Preclinical reports describe effects on exercise capacity, muscle metabolism, and blood lipid levels in rodents, but these findings come from controlled laboratory settings. The compound has low oral bioavailability in animals, which limits systemic exposure after swallowing. Investigators often use injected routes in experiments to achieve measurable plasma concentrations. Human clinical data are sparse, no approved therapeutic product exists, and whether animal effects translate to humans remains an open question.
Regulatory and sporting contexts treat SR9009 as a prohibited substance in many elite competitions. Its presence on banned lists reflects concerns about performance enhancement and unknown long-term safety. Analytical chemists have developed methods to detect the parent compound and its metabolites in urine and blood. Literature discussions distinguish between in vitro potency, animal pharmacology, and anecdotal human reports. The latter are difficult to verify because products sold online may lack purity or contain different compounds.
Phthalimide is used as a precursor to anthranilic acid, a precursor to azo dyes and saccharin. Alkyl phthalimides are useful precursors to amines in chemical synthesis, especially in peptide synthesis where they are used "to block both hydrogens and avoid racemization of the substrates". Alkyl halides can be converted to the N-alkylphthalimide:
=== Normal tissue and immune expression === ITGA1 (integrin subunit alpha 1; CD49a/VLA1) is expressed across multiple tissue and cellular compartments. When it comes to cells, ITGA1 is expressed in multiple cell types such as epithelial cells, endothelial cells, stromal cells, and immune cells. Among immune cells, ITGA1 is specifically expressed on decidual natural killer (dNK) cells more than peripheral blood NK (pNK) cells. This tissue-specific expression contributes to the specialized functional properties of dNK cells previously stated (regulation of adhesion, migration, and immune activity at the maternal-fetal interface). Reduced expression of CD49 has been observed in dNK cells of patients with recurrent spontaneous abortion, which indicates a disease-associated dysregulation of ITGA1 expression. The molecular regulation of ITGA1 expression within immune cells involves non-coding RNA mechanisms. In human dNK cells, the long non-coding RNA: Inc-49a has been identified as a positive regulator of CD49a expression, influencing CD49a-dependent immune cell migration, adhesion, and cytotoxic regulation.
=== Notable incidents of use === DJ Screw, who popularized the codeine-based drink, died of a codeine–promethazine, Valium, and PCP overdose on November 16, 2000, several months after the video of Three 6 Mafia's single debuted. Big Moe, a DJ Screw protégé whose albums City of Syrup and Purple World were based on the drink and who has been described as having "rapped obsessively about the drug", died at age 33 on October 14, 2007, after suffering a heart attack one week earlier that left him in a coma. There was speculation that lean may have contributed to his death. Pimp C, a widely influential rapper from Port Arthur, Texas, and member of the rap duo UGK, was found dead on December 4, 2007, at the Mondrian Hotel in West Hollywood, California. The Los Angeles County Coroner's Office reported that the rapper's death was "due to promethazine-codeine effects and other unestablished factors." Ed Winter, assistant chief of the Coroner's Office, said the levels of the medication were elevated, but not enough to deem the death an overdose. However, Pimp C had a history of sleep apnea, a condition that causes one to stop breathing for short periods during sleep. A spokesman for the coroner's office said that the combination of sleep apnea and cough medication probably suppressed Pimp C's breathing long enough to bring on his death. Fredo Santana, an American rapper who frequently made references to the drink in his music, died of a seizure on January 19, 2018.
Peukert saw his work as a "warning against the fallacious notion that the normality of industrial society is harmless" and urged historians to consider the "dark side of modernity", instead of seeing modernity as a benign development that was always for the best. Peukert wrote: "The view that National Socialism was...one of the pathological development forms of modernity does not imply that barbarism is the inevitable logical outcome of modernization. The point, rather, is that we should not analyse away the tensions between progressive and aberrant features by making a glib opposition between modernity and tradition: we should call attention to the rifts and danger-zones which result from the civilizing process itself, so that the opportunities for human emancipation which it simultaneously creates can be more thoroughly charted. The challenges of Nazism shows that the evolution to modernity is not a one-way trip to freedom. The struggle for freedom must always be resumed afresh, both in inquiry and in action". Peukert argued that though völkisch racism was extreme, it was by no means exceptional, and instead reflected the logic promoted by the social sciences throughout the West which had argued that the state can and should foster "normality" while identifying "the non-conformity that is to be segregated and eliminated". Seen in this perspective, for Peukert the genocide against the Jews and Romany were only part of a wider project to eliminate all unhealthy genes from the volksgemeinschaft.
As cirrhosis can be caused by many different entities that injure the liver in different ways, cause-specific abnormalities may be seen. For example, in chronic hepatitis B, there is infiltration of the liver parenchyma with lymphocytes. In congestive hepatopathy there are erythrocytes and a greater amount of fibrosis in the tissue surrounding the hepatic veins. In primary biliary cholangitis, there is fibrosis around the bile duct, the presence of granulomas and pooling of bile. Lastly in alcoholic cirrhosis, there is infiltration of the liver with neutrophils. Macroscopically, the liver is initially enlarged, but with the progression of the disease, it becomes smaller. Its surface is irregular, the consistency is firm, and if associated with steatosis, the color is yellow. Depending on the size of the nodules, there are three macroscopic types: micronodular, macronodular, and mixed cirrhosis. In the micronodular form (Laennec's cirrhosis or portal cirrhosis), regenerating nodules are under 3 mm. In macronodular cirrhosis (post-necrotic cirrhosis), the nodules are larger than 3 mm. Mixed cirrhosis consists of nodules of different sizes.
Sources: en.wikipedia.org
=== RNA interference === RNA interference (RNAi) uses segments of RNA to fatally silence crucial insect genes. In 2024 two uses of RNAi have been registered by the authorities for use: Genetic modification of a crop to introduce a gene coding for an RNAi fragment and spraying double stranded RNA fragments onto a field. Monsanto introduced the trait DvSnf7 which expresses a double-stranded RNA transcript containing a 240 bp fragment of the WCR Snf7 gene of the Western Corn Rootworm. GreenLight Biosciences introduced Ledprona, a formulation of double stranded RNA as a spray for potato fields. It targets the essential gene for proteasome subunit beta type-5 (PSMB5) in the Colorado potato beetle.
==== Physiological and metabolic consequences ==== OSA in adults is associated with a higher risk for cardiovascular morbidities, diabetes, hypertension, coronary artery disease and stroke – OSA might have a role in the etiology of these conditions. Those conditions may lead to increased mortality that an appropriate treatment for OSA may reduce. OSA is often linked with hypertension as it induces an increase in sympathetic activity that can lead to the elevation of blood pressure. The OSA-related hypercapnia has been suggested to be related to the development of hypertension. Treating the OSA may prevent the development of hypertension. The relationship between OSA and excess body weight is complex, as obesity is more prevalent amongst OSA patients but can also be a risk factor for the development of OSA – it accounts for 58% of adult cases. Thus, both OSA and obesity (when present) may work synergistically and lead to hyperlipidemia, diabetes, insulin resistance and other symptoms of the metabolic syndrome. The metabolic syndrome itself is often associated with OSA: 74–85% of OSA patients are diagnosed with it. CPAP therapy can lead to an improvement of some of the cardiovascular component of the metabolic syndrome while weight loss is also recommended for its positive effects on OSA consequences and metabolic dysfunctions. An intervention comprising exercise and diet is thus effective for the treatment of OSA as it positively impacts the severity of both obesity symptoms and OSA symptoms.
In 1984, Applied Biosystems sales revenue tripled to over US$18 million, with a second yearly profit, and with over 200 employees. Services included synthesizing custom DNA and protein fragments, and the sequencing of protein samples submitted from customers. The third major instrument made by Applied, the Model 430A Peptide Synthesizer, was introduced. In 1985, Applied Biosystems sales revenue grew nearly 70% to over US$35 million, with a third yearly profit. Two new products included the Model 380B DNA Synthesizer and the 381A DNA Synthesizer. That year the company went international for the first time, when it established a wholly owned subsidiary in Great Britain to save shipping costs on chemical sales, which overall by then accounted for 17% of sales. Also in 1985, Applied Biosystems acquired Brownlee Labs, a manufacturer of columns and pumps for high-performance liquid chromatography (HPLC) systems, after its founder, Robert Brownlee was diagnosed with AIDS-related complex in 1984. Brownlee's technology brought the new on-line 120A PTH Amino Acid Analyzer. However, Brownlee then began a new company, which was viewed by Applied as a competitor. In 1989 Applied and Brownlee settled in a lawsuit over the conflict. As late as 1990, Brownlee publicly discussed what had been his contributions in the rocky relationship with Applied, before he died early the next year. In 1986, Andre Marion became president and chief executive officer. Sales revenue increased by 45% to nearly US$52 million. The company introduced six new products, totalling eleven automated instruments.
Lepirudin is an anticoagulant that functions as a direct thrombin inhibitor. Brand name: Refludan, Generic: Lepirudin rDNA for injection. Lepirudin is a recombinant hirudin derived from yeast cells. Lepirudin is almost identical to hirudin extracted from Hirudo medicinalis, having the amino acid sequence LTYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ with disulfide bridges at Cys6-Cys14, Cys16-Cys28 and Cys22-Cys39, and differs from by the substitution of leucine for isoleucine at the N-terminal end of the molecule and the absence of a sulfate group on the tyrosine at position 63. Lepirudin may be used as an anticoagulant when heparins (unfractionated or low-molecular-weight) are contraindicated because of heparin-induced thrombocytopenia.
Sources: en.wikipedia.org
Laboratories commonly use liquid chromatography coupled with mass spectrometry to detect SR9009. The method can identify the compound and estimate concentration in a sample. Detection limits depend on the matrix and instrument.
Research-grade purity indicates a supplier's measured percentage of the intended compound. It does not guarantee safety, sterility, or suitability for human consumption. Buyers should request a certificate of analysis with chromatograms and test methods.
Sports regulators prohibit SR9009 because it is a non-approved substance with potential performance-altering effects. Its presence can be detected in anti-doping testing. Athletes are responsible for substances found in their samples.
No. It is an investigational compound without approved therapeutic indications. It is sold for research purposes only in many jurisdictions.