sr9009-notes.peptides6155.com › Blog › Handling Storage And Quality Control — Complete Guide

Handling Storage And Quality Control — Complete Guide

By Editorial Desk · published 2026-07-02 · last reviewed 2026-08-01 · Blog

A practical reference on SR9009: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.

This page was last updated on 2026-08-01 and is reviewed periodically as new material appears.

Handling Storage and Quality Control

Storage conditions for research-grade SR9009 generally involve a freezer at approximately minus twenty degrees Celsius, sometimes lower for long-term preservation. Containers should remain tightly closed and protected from light. Desiccants may be used to limit moisture uptake. Solutions are often stored in aliquots to avoid repeated warming and cooling. Stability data for the compound under various conditions are limited, so laboratories typically follow supplier recommendations and verify performance through periodic analytical checks rather than assuming indefinite stability.

Identity and purity testing for SR9009 commonly uses liquid chromatography coupled with tandem mass spectrometry. This method separates the compound from matrix components and detects it by mass-to-charge transitions, providing sensitive and specific confirmation. Nuclear magnetic resonance spectroscopy can support structural identification, while high-performance liquid chromatography with ultraviolet detection may estimate purity. Because online products labeled as SR9009 may contain other substances or no active compound at all, independent verification is important in research settings. Certificates of analysis are useful but not a substitute for in-house testing.

Laboratory samples of SR9009 are typically supplied as a white to off-white powder. The compound dissolves readily in organic solvents such as dimethyl sulfoxide and ethanol, while its solubility in water is low. Because of this solubility profile, researchers often prepare concentrated stock solutions in an organic solvent before diluting them into aqueous assay buffers. Light exposure, moisture, and repeated freeze-thaw cycles can degrade many small molecules, so handling procedures usually aim to minimize these factors. Purity is commonly checked before use.

Background and Mechanism of SR9009

SR9009 is frequently discussed in fitness and research-chemical contexts, yet it has no approved medical indication. Regulatory agencies have not authorized it for human use, and it is not a standard prescription drug. Some sports organizations list it as a prohibited substance because of its potential performance-enhancing properties. Published human data are sparse, so claims about its effects in people often rely on animal models or anecdotal reports. Quality and identity of online materials can vary widely.

SR9009 is a synthetic small molecule studied as a REV-ERB agonist. REV-ERBα and REV-ERBβ are nuclear receptors that help regulate circadian rhythms and metabolic gene expression. The compound was identified in academic screening efforts to find synthetic ligands for these receptors. In cell and animal studies, SR9009 alters transcription of genes involved in lipid and glucose metabolism, and it can shift circadian behavior. It is not an approved therapeutic agent.

Sr9009 at a glance

PropertyValueNotes
AppearanceWhite to off-white powderTypical for research-grade material
SolubilitySoluble in DMSO and ethanol; low aqueous solubilityOrganic stock solutions are common
Typical storage temperature-20 °C or lowerProtect from light and moisture
Common analytical methodLC-MS/MSUsed for detection and confirmation
Common synonymsSR9009; StenabolicStenabolic is an informal name

Regulation, Testing, and Storage

Detection of SR9009 in biological samples usually employs liquid chromatography coupled with tandem mass spectrometry. This method can identify the parent compound and sometimes metabolites in urine or blood. Because exposure can be low and clearance may be rapid, sample timing and limits of detection matter. Laboratories validate assays for sensitivity and specificity. Results are interpreted alongside chain-of-custody and quality-control records. Urine is the common matrix for anti-doping analysis, while blood may be used in research settings.

Handling recommendations for SR9009 in a laboratory setting include storing the solid at low temperature, protected from light and moisture. The compound is often dissolved in dimethyl sulfoxide or ethanol for experiments. Solutions should be prepared with appropriate personal protective equipment and disposed of according to local rules. Stability data for long-term storage are limited, so stock solutions are typically kept cold and used within defined periods. Records of preparation date and concentration support reproducibility.

Related pages on this site

Background and Research Status

SR9009 is a synthetic small molecule studied as an agonist of the nuclear receptors REV-ERBα and REV-ERBβ. It is not a steroid, peptide, or natural hormone. In scientific literature, it appears under the code SR9009 and in non-scientific contexts as Stenabolic. The compound was identified through chemical screening efforts aimed at targeting circadian clock components. Its status remains investigational, and no regulatory agency has approved it as a human medicine.

REV-ERB proteins help regulate daily cycles in gene expression, including genes tied to lipid and glucose metabolism. SR9009 binds these receptors and alters their activity in cell and animal experiments. Consequences observed in rodents include changes in skeletal muscle oxidative capacity, blood lipid levels, and exercise performance. The precise chain from receptor occupancy to whole-body effects is still an active area of study. Human responses cannot be assumed from rodent data.

SR9009 Identity and Mechanism

REV-ERB proteins typically suppress gene expression by recruiting corepressor complexes to DNA response elements. SR9009 binds these receptors and strengthens that repressive action in cell-based assays. Studies in rodents have reported changes in lipid handling, mitochondrial function, and exercise capacity after treatment. Such findings are often cited as evidence for metabolic effects, but species differences and limited pharmacokinetic data make direct translation to humans uncertain. Researchers continue to examine which effects are robust and which depend on specific experimental conditions.

SR9009 is frequently discussed alongside other REV-ERB ligands, including synthetic agonists and natural heme-related molecules. Its selectivity for REV-ERB over related nuclear receptors has been measured in binding and reporter assays, though off-target activity at higher concentrations is possible. The compound is prohibited in sport by the World Anti-Doping Agency, and it is not approved for any medical use in major jurisdictions. Products sold online may be labeled as research chemicals, and their identity and purity are not guaranteed by regulatory review.

SR9009 is a synthetic small molecule that acts on the nuclear receptors REV-ERBα and REV-ERBβ. These receptors are part of the circadian clock machinery and normally repress transcription of certain target genes. In laboratory research, SR9009 is used as a chemical tool to study how REV-ERB activity influences metabolism, inflammation, and daily biological rhythms. The compound is not an approved medicine, and its effects in humans remain largely uncharacterized. It is often described as an investigational agent rather than a therapeutic product.

Analytical Detection and Regulatory Status

Analytical methods for SR9009 typically rely on liquid chromatography coupled with tandem mass spectrometry. The technique can separate the parent compound from related substances and detect low concentrations in biological matrices. Urine and blood are common samples in anti-doping testing, while in vitro studies may use cell culture media. Rapid metabolism and low expected concentrations make method validation important for reliable identification. Exact metabolite patterns can vary by species and are not fully mapped.

Regulatory treatment of SR9009 reflects its investigational status. The compound has no approved human therapeutic indication, and sports authorities prohibit its use. It appears on anti-doping lists as a non-approved substance or metabolic modulator, depending on the list version. Products sold online as research chemicals are not quality-controlled medicines, so their identity and purity can differ from the label. Such products may also contain unlisted compounds, which complicates both testing and safety assessment.

Scientific discussion of SR9009 often separates animal evidence from human anecdote. Rodent studies provide controlled data on endurance, metabolism, and gene expression, but they use specific strains, doses, and treatment durations. Human reports are mostly uncontrolled and cannot establish cause and effect. Open questions include oral bioavailability, tissue distribution, metabolic stability, and long-term effects. Review articles generally call for more rigorous pharmacokinetic and safety research before any clinical use could be considered.

Supporting material

ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).

Molecular biomarkers have been defined as biomarkers that can be discovered using basic and acceptable platforms such as genomics and proteomics. Many genomic and proteomics techniques are available for biomarker discovery and a few techniques that are recently being used can be found on that page. Apart from genomics and proteomics platforms biomarker assay techniques, metabolomics, lipidomics, glycomics, and secretomics are the most commonly used as techniques in identification of biomarkers. Biomarkers can be classified on their clinical applications as molecular biomarkers, cellular biomarkers or imaging biomarkers. Four of the main types of molecular biomarkers are genomic biomarkers, transcriptomic biomarkers, proteomic biomarkers and metabolic biomarkers.

Although an estimated 43,000 species of bacteria have been named, most of them have never been studied. In fact, just 10 bacterial species account for half of all publications, whereas nearly 75% of all named bacteria have no academic research devoted to them. The best-studied species, Escherichia coli, has more than 300,000 studies published on it, but many of these papers likely use it only as a cloning vehicle to study other species, without providing any insight into its own biology. 90% of scientific studies on bacteria focus on less than 1% of species, mostly pathogenic bacteria relevant to human health. While E. coli is probably the best-studied bacterium, a quarter of its 4000 genes are poorly studied or remain uncharacterized. Some bacteria with minimal genomes (< 600 genes, e.g. Mycoplasma) usually have a large fraction of their genes functionally characterized, given that most of them are essential and conserved in many other species.

On 1 March, the Department of Food and Veterinary of Lithuania announced that horse meat was found in three canned beef brands sold by Latvian company Kuršu Zeme. Canned beef made by the Latvian company was removed from sale in Lithuania. === Wiljo Import en Export B.V. and Vleesgroothandel Willy Selten B.V. === On 10 April 2013, it was reported that two Dutch trading companies, owned by the same person whom food safety officials had previously investigated, may have supplied 50,000 metric tonnes of adulterated beef containing horse meat since January 2011. On 7 February 2013, it was revealed by the Food Standards Agency that the Findus beef lasagne range in the UK, France, Norway, and Sweden, and the shepherd's pie and moussaka ranges in France, contained horse meat without proper declaration or official scrutiny. The contamination may have gone on since summer 2012 according to a leaked document.

The angiotensin II receptors, (ATR1) and (ATR2), are a class of G protein-coupled receptors with angiotensin II as their ligands. They are important in the renin–angiotensin system: they are responsible for the signal transduction of the vasoconstricting stimulus of the main effector hormone, angiotensin II. The AT1 and AT2 receptors share a sequence identity of ~30%, but have a similar affinity for angiotensin II, which is their main ligand. The AT1 receptor is the best elucidated angiotensin receptor. The AT1 subtype is found in the heart, blood vessels, kidney, adrenal cortex, lung and circumventricular organs of brain, basal ganglia, brainstem and mediates the vasoconstrictor effects. The angiotensin receptor is activated by the vasoconstricting peptide angiotensin II. The activated receptor in turn couples to Gq/11 and Gi/o and thus activates phospholipase C and increases the cytosolic Ca2+ concentrations, which in turn triggers cellular responses such as stimulation of protein kinase C. Activated receptor also inhibits adenylate cyclase and activates various tyrosine kinases.

Sources: en.wikipedia.org

Supporting material

The removal of dead cells by neighboring phagocytic cells has been termed efferocytosis. Dying cells that undergo the final stages of apoptosis display apoptotic-cell associated molecular patterns (ACAMPs), such as phosphatidylserine on the outer leaflet of the cell membrane. Phosphatidylserine is normally found on the inner leaflet surface of the plasma membrane, but is redistributed during apoptosis to the extracellular surface by a protein known as scramblase. These molecules mark the cell for phagocytosis by cells possessing the appropriate receptors, such as macrophages. The removal of dying cells by phagocytes occurs in an orderly manner without eliciting an inflammatory response. During apoptosis cellular RNA and DNA are separated from each other and sorted to different apoptotic bodies; separation of RNA is initiated as nucleolar segregation.

Caddisfly silk is silk that is secreted by the silk glands of the caddisfly (Trichoptera), similar to Lepidoptera silkworms (B. mori). The larvae use silk to hunt and defend themselves. The silk's underwater binding properties are a subject of ongoing scientific research. Trichoptera, or caddisfly, larvae use silk to hunt and protect themselves in their aquatic environment. Much like silkworms and other Lepidoptera, this silk protein is excreted by specialized silk glands. The silk’s structure is mostly conserved among many different caddisfly species, and can be used to bind debris including rocks, sticks, twigs and shells, as well as to build nets for catching prey. Caddisflies, which spend the majority of their life cycle in the larval stage, need these casings to protect their underbellies and pupate. Caddisfly silk is very strong and durable. Because their silk must be able to bind to a variety of components while completely submerged in water, it is therefore being studied for potential applications as a waterproof adhesive.

The Bergmann degradation begins with benzoylation at the alpha-group of a peptide and subsequent conversion to an acyl azide. As in the Curtius rearrangement, the acyl azide, in the presence of benzyl alcohol and heat, rearranges to a highly reactive isocyanate intermediate, releasing nitrogen gas in the process. The isocyanate in turn reacts with benzyl alcohol to form a benzylurethane (also referred to as carboxybenzyl), a compound possessing a carbamate amine protecting group. Subsequent removal of the carbamate protecting group is carried out by catalytic hydrogenation in the presence of hydrochloric acid followed by addition to boiling water, yielding an unstable intermediate that rapidly rearranges to release carbon dioxide, driving the reaction forward. This leads to further rearrangement and subsequent hydrolysis, ultimately resulting in the formation of an aldehyde bearing the next amino acid residue in the sequencing series and the expulsion of the residual peptide in amide form.

Recombinant DNA technology arose as a result of advances in biology that began in the 1950s and '60s. During these decades, a tradition of merging the structural, biochemical, and informational approaches to the central problems of classical genetics became more apparent. Two main underlying concepts of this tradition were that genes consisted of DNA and that DNA encoded information that determined the processes of replication and protein synthesis. These concepts were embodied in the model of DNA produced through the combined efforts of James Watson, Francis Crick, Rosalind Franklin, and Maurice Wilkins. Further research on the Watson-Crick model yielded theoretical advances that were reflected in new capacities to manipulate DNA. One of these capacities was recombinant DNA technology.

Sources: en.wikipedia.org

Frequently asked questions

How should SR9009 be stored?

Research-grade SR9009 is typically stored frozen at about minus twenty degrees Celsius, protected from light and moisture. Stock solutions are often kept in aliquots to avoid repeated freeze-thaw cycles. Specific storage conditions should follow the supplier's documentation.

What analytical method detects SR9009?

Liquid chromatography with tandem mass spectrometry is widely used to detect and confirm SR9009 in laboratory samples. The technique offers high sensitivity and can distinguish the target compound from related substances. Nuclear magnetic resonance and ultraviolet detection may support identity and purity checks.

Why is purity testing important?

Online products labeled as SR9009 may vary in identity, purity, and actual content. Independent testing helps confirm that a sample matches its label and does not contain unexpected contaminants. This is important for reproducible research and for interpreting experimental results.

What is SR9009?

SR9009 is a synthetic compound investigated as an agonist of the nuclear receptors REV-ERBα and REV-ERBβ. It is used in preclinical research on circadian rhythm and metabolism. It is not an approved drug.

Network