LC-MS/MS is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Updated 2025-10-14. Numbers and descriptions here follow the published literature rather than marketing material.
SR9009 is not approved as a medicine by major regulatory agencies. It is commonly sold as a research chemical, a category that may fall outside customary drug approval and quality rules. In sports, the World Anti-Doping Agency lists SR9009 as a prohibited substance. Athletes who use it can face sanctions if it is detected in a sample. Legal status varies by country, and importation may be restricted. Enforcement practices differ across borders.
Detection of SR9009 in biological samples usually employs liquid chromatography coupled with tandem mass spectrometry. This method can identify the parent compound and sometimes metabolites in urine or blood. Because exposure can be low and clearance may be rapid, sample timing and limits of detection matter. Laboratories validate assays for sensitivity and specificity. Results are interpreted alongside chain-of-custody and quality-control records. Urine is the common matrix for anti-doping analysis, while blood may be used in research settings.
SR9009 is a synthetic small molecule studied as an agonist of the nuclear receptors REV-ERBα and REV-ERBβ, also called NR1D1 and NR1D2. These receptors help regulate circadian rhythms and metabolic gene programs. The compound was developed for laboratory research, not as an approved therapeutic. Its identity is distinct from steroid hormones and selective androgen receptor modulators. Scientific interest centers on how REV-ERB activation changes gene expression in cells and animal models.
At the molecular level, SR9009 binds the ligand-binding domain of REV-ERB and strengthens recruitment of corepressor proteins such as NCoR and HDAC3. This increases repression of target genes, including Bmal1 and other clock-controlled and metabolic genes. In rodent studies, such changes have been linked to altered lipid handling, glucose metabolism, and energy expenditure. The precise chain of events between receptor binding and whole-body effects remains an active area of research. Findings in animals do not automatically translate to humans.
| Property | Value | Notes |
|---|---|---|
| Regulatory status | Not approved as a medicine in major jurisdictions | Sold as a research chemical; legal status varies |
| Anti-doping status | Prohibited by the World Anti-Doping Agency | Listed under non-approved substances or related category |
| Typical analytical method | LC-MS/MS | Used for detection and confirmation in biological samples |
| Storage temperature | −20 °C or lower for solid | Desiccated and protected from light |
| Common solution solvents | DMSO; ethanol | Aqueous solubility is limited |
Regulatory treatment of SR9009 reflects its investigational status. The compound has no approved human therapeutic indication, and sports authorities prohibit its use. It appears on anti-doping lists as a non-approved substance or metabolic modulator, depending on the list version. Products sold online as research chemicals are not quality-controlled medicines, so their identity and purity can differ from the label. Such products may also contain unlisted compounds, which complicates both testing and safety assessment.
Scientific discussion of SR9009 often separates animal evidence from human anecdote. Rodent studies provide controlled data on endurance, metabolism, and gene expression, but they use specific strains, doses, and treatment durations. Human reports are mostly uncontrolled and cannot establish cause and effect. Open questions include oral bioavailability, tissue distribution, metabolic stability, and long-term effects. Review articles generally call for more rigorous pharmacokinetic and safety research before any clinical use could be considered.
SR9009 is a synthetic small molecule developed as an agonist of the nuclear receptors REV-ERBα (NR1D1) and REV-ERBβ (NR1D2). These receptors help regulate circadian rhythms and metabolic gene expression. In cell and animal studies, SR9009 alters transcription of genes involved in lipid metabolism, inflammation, and mitochondrial function. It is not an approved medicine, and its pharmacological profile in humans remains largely uncharacterized. The compound is frequently discussed in the context of circadian biology and metabolic research rather than clinical use.
Preclinical reports have linked SR9009 to improved endurance and altered energy expenditure in rodents. Such findings have prompted interest in whether REV-ERB activation can influence skeletal muscle metabolism. However, the reported effects depend on dose, route, and experimental model, and replication across laboratories is limited. Human trials have not established comparable outcomes, so claims about exercise performance remain speculative. The absence of controlled human data is a central limitation in interpreting these observations.
The mechanism of action involves binding to REV-ERB receptors and recruiting corepressor complexes, which represses target gene transcription. This contrasts with many nuclear receptor agonists that activate transcription. Downstream effects may include changes in autophagy, mitochondrial biogenesis, and lipid handling, but the precise pathways remain an active area of study. Whether these molecular events translate into meaningful physiological effects in humans is unresolved. Most evidence comes from cultured cells and rodent models rather than human participants.
Other medications used include glucocorticoids (Deflazacort, Vamorolone); calcium channel blockers (Diltiazem); to slow skeletal and cardiac muscle degeneration, anticonvulsants to control seizures and some muscle activity, and Histone deacetylase inhibitors (Givinostat) to delay damage to dying muscle cells. Various figures of the occurrence of Duchenne muscular dystrophy are reported. One source reports that it affects about one in 3,500 to 6,000 males at birth in the U.S., (or 17 to 29 per 100,000 U.S. male births). Another source reports Duchenne muscular dystrophy being a rare disease and having an occurrence of 7.1 per 100,000 male births globally. A number of sources referenced in this article indicate an occurrence of 6 per 100,000. Duchenne muscular dystrophy is the most common type of muscular dystrophy, with a median life expectancy of 27–31 years. However, with comprehensive care, some individuals may live into their 30s or 40s. Duchenne muscular dystrophy is considerably rarer in females, occurring in approximately one in 50,000,000 live female births.
March 14: A decree provides that Chambers of Commerce and Consultative Chambers of Arts and Manufacturing include women among both voters and eligible candidates. April 3: Law modifying Articles 334 and 335 of the Penal Code and Articles 5 and 7 of the Code of Criminal Procedure; notably amends provisions relating to pimping, the corruption of minors, incitement to debauchery, corruption of youth, and international trafficking. December 15, 1904: Abolition of the ban on marrying the "accomplice in adultery." February 7, 1905: Decree implementing the international agreement aimed at effectively protecting against the criminal trade known as "white slavery" (international agreement from May 1904). 1907
To fill an iatrogenic defect or cavity caused by significant tissue loss due to injury, surgical excision or debridement, which would predispose the area to postoperative seroma and/or abscess formation; To close a gaping wound that cannot be sutured directly, have difficulty healing by secondary intention and the remaining tissue is unable to support a graft; To reduce tension across the wound, which would disrupt healing and lead to excessive scarring or wound dehiscence, or; To reconstruct complex anatomic structures like breasts or jaws, as flaps may also carry over tissues such as muscles and bones that may be useful in partially restoring functions within the body region.
Sources: en.wikipedia.org
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
Alyx Vance was created for the video game Half-Life 2, and her design was created by Dhabih Eng. Her motions are performed by actress Jamil Mullen, who also provides the face design. She is voiced by Merle Dandridge in Half-Life 2 and its episodes, and Ozioma Akagha in Half-Life: Alyx. According to Half-Life writer Marc Laidlaw, the relationship between Alyx and the G-Man was based on the relationship between Elena Hausmann and Slowstop from his novel The Third Force: A Novel of Gadget (1996), based on Synergy's computer game Gadget: Invention, Travel, & Adventure (1993).
The primary adverse effect of any insulin product is hypoglycemia, or low blood sugar. Hypoglycemia can manifest as dizziness, disorientation, trouble speaking, and changes in mental status. In severe cases, hypoglycemia can lead to loss of consciousness if not treated. As lente insulin continues to be absorbed in the body for hours after use, these signs and symptoms may be delayed from the time of administration and begin with little or no warning.
The Ghana Police Service and the Criminal Investigation Department are the main law enforcement agencies, responsible for the detection of crime, maintenance of law and order and the maintenance of internal peace and security. The Ghana Police Service has eleven specialised police units, including a Militarized police Rapid deployment force and Marine Police Unit. The Ghana Police Service operates in 12 divisions: ten covering the regions of Ghana, one assigned specifically to the seaport and industrial hub of Tema, and the twelfth being the Railways, Ports and Harbours Division. The Ghana Police Service's Marine Police Unit and Division handles issues that arise from the country's offshore oil and gas industry.
Sources: en.wikipedia.org
Methoxypyrazines Esters: Ethyl acetate is the most common ester in wine, being the product of the most common volatile organic acid — acetic acid, and the ethyl alcohol generated during the fermentation. Norisoprenoids, such as C13-norisoprenoids found in grape (Vitis vinifera) or wine, can be produced by fungal peroxidases or glycosidases.
=== Feminist collages === In February 2019, she began posting collages which featured brief feminist slogans in public spaces across France, particularly in Paris and Marseille. Her collages are composed of black letters painted one by one on white sheets. Her first slogan was "Since I was 13, men have commented on my physical appearance in the street."
== External links == Human ANG genome location and ANG gene details page in the UCSC Genome Browser. Human RNASE4 genome location and RNASE4 gene details page in the UCSC Genome Browser. Human AMOT genome location and AMOT gene details page in the UCSC Genome Browser. Overview of all the structural information available in the PDB for UniProt: P03950 (Human Angiogenin) at the PDBe-KB. Overview of all the structural information available in the PDB for UniProt: P21570 (Mouse Angiogenin) at the PDBe-KB.
Sources: en.wikipedia.org
Its legal status depends on the country and intended use. It is not an approved medicine in major jurisdictions. In sport, it is prohibited by anti-doping rules.
Laboratories typically use LC-MS/MS to detect SR9009 and related compounds in urine or blood. The method is sensitive but depends on sample collection timing. Confirmatory analysis follows quality-control procedures.
Solid material is generally kept cold, dry, and protected from light. Solutions are often stored in sealed containers at low temperature. Stability beyond recommended periods is not well documented.
SR9009 is a synthetic research compound that activates the REV-ERBα and REV-ERBβ nuclear receptors. It is not an approved drug and has no established human therapeutic use. Most published biological data come from cell and rodent studies.