The short version of anti-doping fits in a sentence. The long version — which is the one that helps — is below.
This page was last updated on 2026-04-08 and is reviewed periodically as new material appears.
Detection of SR9009 in biological samples usually employs liquid chromatography coupled with tandem mass spectrometry. This method can identify the parent compound and sometimes metabolites in urine or blood. Because exposure can be low and clearance may be rapid, sample timing and limits of detection matter. Laboratories validate assays for sensitivity and specificity. Results are interpreted alongside chain-of-custody and quality-control records. Urine is the common matrix for anti-doping analysis, while blood may be used in research settings.
Handling recommendations for SR9009 in a laboratory setting include storing the solid at low temperature, protected from light and moisture. The compound is often dissolved in dimethyl sulfoxide or ethanol for experiments. Solutions should be prepared with appropriate personal protective equipment and disposed of according to local rules. Stability data for long-term storage are limited, so stock solutions are typically kept cold and used within defined periods. Records of preparation date and concentration support reproducibility.
SR9009 is not approved as a medicine by major regulatory agencies. It is commonly sold as a research chemical, a category that may fall outside customary drug approval and quality rules. In sports, the World Anti-Doping Agency lists SR9009 as a prohibited substance. Athletes who use it can face sanctions if it is detected in a sample. Legal status varies by country, and importation may be restricted. Enforcement practices differ across borders.
SR9009 is a synthetic small molecule that acts on the nuclear receptors REV-ERBα and REV-ERBβ. These receptors are part of the circadian clock machinery and normally repress transcription of certain target genes. In laboratory research, SR9009 is used as a chemical tool to study how REV-ERB activity influences metabolism, inflammation, and daily biological rhythms. The compound is not an approved medicine, and its effects in humans remain largely uncharacterized. It is often described as an investigational agent rather than a therapeutic product.
REV-ERB proteins typically suppress gene expression by recruiting corepressor complexes to DNA response elements. SR9009 binds these receptors and strengthens that repressive action in cell-based assays. Studies in rodents have reported changes in lipid handling, mitochondrial function, and exercise capacity after treatment. Such findings are often cited as evidence for metabolic effects, but species differences and limited pharmacokinetic data make direct translation to humans uncertain. Researchers continue to examine which effects are robust and which depend on specific experimental conditions.
| Property | Value | Notes |
|---|---|---|
| Regulatory status | Not approved as a medicine in major jurisdictions | Sold as a research chemical; legal status varies |
| Anti-doping status | Prohibited by the World Anti-Doping Agency | Listed under non-approved substances or related category |
| Typical analytical method | LC-MS/MS | Used for detection and confirmation in biological samples |
| Storage temperature | −20 °C or lower for solid | Desiccated and protected from light |
| Common solution solvents | DMSO; ethanol | Aqueous solubility is limited |
SR9009 is a synthetic small molecule studied as an agonist of the nuclear receptors REV-ERBα and REV-ERBβ. These receptors help regulate circadian rhythms and metabolic gene expression. In laboratory experiments, SR9009 binds these receptors and alters transcription of genes involved in lipid handling, glucose metabolism, and mitochondrial function. It is not a naturally occurring compound and has no approved therapeutic use. Research interest stems from its ability to modify energy metabolism in cells and animal models.
In rodent studies, SR9009 has been reported to increase mitochondrial content in skeletal muscle and improve exercise endurance under some conditions. These findings led to popular descriptions such as an exercise mimetic, although that term oversimplifies the biology. Effects vary by dose, timing, tissue, and model. The compound's influence on circadian pathways means that time of administration can matter in experiments. Whether similar metabolic changes occur in humans remains largely unexplored in controlled published trials.
Pharmacokinetic data for SR9009 are limited in published literature. Some reports indicate low oral bioavailability and rapid clearance in animals, which complicates interpretation of exposure and effect. Researchers often use injected routes in preclinical work to achieve measurable systemic levels. Analytical studies rely on mass spectrometry to detect the parent compound and its metabolites. Questions about tissue distribution, active metabolites, and long-term consequences remain open. Species differences in metabolism can affect observed half-life and target engagement.
Analytical identification and purity assessment often use high-performance liquid chromatography with ultraviolet detection or mass spectrometry. Liquid chromatography–tandem mass spectrometry is used to detect and quantify SR9009 in biological matrices, including urine and blood, for anti-doping or pharmacokinetic studies. Nuclear magnetic resonance spectroscopy can confirm molecular structure. Stability depends on form and storage: the solid is generally more stable than solutions, and repeated freeze–thaw cycles may degrade samples. Purity is typically reported as a percentage from a certificate of analysis.
Regulatory treatment of SR9009 varies by country and context. It is not approved as a therapeutic drug by agencies such as the United States Food and Drug Administration or the European Medicines Agency. Sports authorities list it as a prohibited substance; the World Anti-Doping Agency classifies it among hormone and metabolic modulators. Legal status for personal possession or sale differs across jurisdictions, and some countries may restrict it under analog or research chemical laws. Buyers who seek verified material often rely on independent laboratory testing because online product labels may not match contents.
Several misconceptions surround SR9009. It is often described as a SARM, a steroid, or an exercise pill, but its known target is the REV-ERB receptor family. Rodent studies have examined exercise capacity and metabolic markers, yet human outcomes remain unproven. Oral bioavailability appears low in animals, and human pharmacokinetics are not well characterized. Online products may contain impurities or different compounds, so identity and purity testing are important for research use.
Analytical chemists detect SR9009 with liquid chromatography-tandem mass spectrometry, commonly abbreviated LC-MS/MS. Sample preparation may involve protein precipitation, liquid-liquid extraction, or solid-phase extraction before analysis. Laboratories can target the parent compound or its metabolites, depending on the matrix and the purpose of testing. Anti-doping methods require sensitive and specific assays because concentrations in biological samples can be low. Reference standards and validated methods are essential for reliable identification and quantification.
Regulatory agencies have not approved SR9009 for human therapeutic use. It is typically sold as a research chemical with labels stating that it is not for human consumption. The World Anti-Doping Agency prohibits the substance in sport, generally under the category of non-approved substances. Customs and national laws may restrict importation, sale, or possession. Product quality and legal status can vary by country and vendor, and therapeutic claims are not permitted in regulated advertising because the compound lacks approval.
Identity and purity of SR9009 samples are usually checked with chromatographic and spectrometric methods. High-performance liquid chromatography can separate the compound from related impurities, while mass spectrometry provides molecular mass confirmation. Nuclear magnetic resonance spectroscopy may be used for structural verification in research settings. No single method proves biological activity, and certificates of analysis should be reviewed alongside raw data. Independent testing is often needed because online products vary widely.
SR9009 stability depends on temperature, moisture, light, and solvent. Solid material is generally kept cool and dry, while solutions may require protection from repeated warming and cooling. Degradation can appear as color changes, precipitate, or new chromatographic peaks. Researchers should follow supplier instructions and their own stability data. Long-term storage conditions for human use have not been established because the compound lacks approved clinical formulation.
=== 1994–1999: Rise and critical acclaim === Carrey played the lead role in Ace Ventura: Pet Detective which was released in February 1994 and went on to gross $72 million in the United States and Canada. Following its success and before the release of his next film, The Mask, which was anticipated to be another hit, Morgan Creek Productions paid him $5 million to reprise his role as Ace Ventura and New Line Cinema offered him $7 million to make a sequel to The Mask and paid him $7 million to appear in Dumb and Dumber, a nearly tenfold increase on his salary for Ace Ventura. The Mask, released in July 1994, grossed $351 million worldwide, and Dumb and Dumber, released in December 1994, was another commercial success, grossing over $270 million worldwide. Carrey received his first Golden Globe Award nomination for Best Actor for his work in The Mask and was voted second on Quigley's Top Ten Money Making Stars Poll, behind Tom Hanks. Carrey portrayed the Batman villain the Riddler in the Joel Schumacher-directed superhero film Batman Forever (1995). The film received mixed reviews, but was a box office success. He reprised his role as Ace Ventura in Ace Ventura: When Nature Calls which was also released in 1995. Like the original film, it was well received by the public, but poorly received by critics. It was a huge box-office success, earning $212 million worldwide in addition to breaking records, with a $40 million opening weekend. Carrey became the first comic actor to be paid an upfront salary of $20 million for his next film, The Cable Guy (1996).
Lepirudin is an anticoagulant that functions as a direct thrombin inhibitor. Brand name: Refludan, Generic: Lepirudin rDNA for injection. Lepirudin is a recombinant hirudin derived from yeast cells. Lepirudin is almost identical to hirudin extracted from Hirudo medicinalis, having the amino acid sequence LTYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ with disulfide bridges at Cys6-Cys14, Cys16-Cys28 and Cys22-Cys39, and differs from by the substitution of leucine for isoleucine at the N-terminal end of the molecule and the absence of a sulfate group on the tyrosine at position 63. Lepirudin may be used as an anticoagulant when heparins (unfractionated or low-molecular-weight) are contraindicated because of heparin-induced thrombocytopenia.
intercalating agent Any chemical compound (e.g. ethidium bromide) that disrupts the alignment and pairing of bases in the complementary strands of a DNA molecule by inserting itself between the bases.
Sources: en.wikipedia.org
In the US, esketamine (brand name Spravato) is a nasal spray indicated, as monotherapy, or in conjunction with an oral antidepressant as a therapy for treatment-resistant depression (TRD) as well as major depressive disorder (MDD) associated with suicidal ideation or behavior in adults. In the clinical trials that led to approval of esketamine, TRD was defined as major depressive disorder with inadequate response to at least two different conventional antidepressants. The nasal spray formulation of esketamine used for depression delivers two sprays containing a total of 28 mg esketamine and doses of 56 mg (2 devices) to 84 mg (3 devices) are used. Esketamine has modest short-term efficacy on TRD (similar in efficacy to atypical antipsychotics); there is limited long-term safety data available and some concerning signals regarding adverse events and abuse potential. Due to concerns about sedation, dissociation, and misuse, esketamine is available for treatment of depression only from certified providers through a restricted program under a Risk Evaluation and Mitigation Strategy (REMS) called Spravato REMS.
== Cancer resistance to immunotherapy == While immunotherapy has provided a tool for combating cancer, a significant clinical challenge comes with it. Cancer cells can develop resistance to immunotherapy treatment, which decreases the efficacy of the treatment. A substantial proportion of patients either begin treatment with resistance, causing failure in response, or develop resistance after the medication is administered. A recent review estimated that a majority of patients with solid tumors eventually acquire resistance to immunotherapy. Resistance to immunotherapy falls under either the category of primary or innate resistance, which causes a lack of response to immunotherapy treatment from the get-go, or acquired resistance, where there is an initial positive response to treatment followed by regression. Resistance arises through mechanisms that alter the interaction between tumor cells, the immune system, and the tumor microenvironment. Tumor antigenicity, or the ability for the immune system to recognize cancer cells, is a primary target for resistance. Resistance mutations that down-regulate (decrease) the expression of antigen-presenting factors allow the immune system to ignore the presence of cancer cells. The major histocompatibility complex (MHC), which presents antigens on the cell surface to prompt immune recognition, is often a target. When T cells can no longer identify malignant cells, this renders therapies and immune recognition useless. A second mechanism of immunotherapy resistance is impaired immune cell function.
==== Mount Koya ==== It was developed by Mokujiki Shonin, a Shingon priest in the early 1600s during the Edo Period. He encouraged all the mountain temples to make their own tofu after he obtained large amounts of soybeans from the head Shingon temple. The purpose of this was to preserve some of the frozen tofu until the Spring equinox. Firm tofu was left outdoors in the cold windy night to freeze. After it was frozen, it was allowed to stand on shelves in a shed for fifteen days at temperatures below freezing, thawed in warm water and pressed lightly to expel the melted ice, then dried in the shed using heat from charcoal braziers.
Sources: en.wikipedia.org
==== New Zealand ==== Sildenafil was reclassified in New Zealand in 2014 so it could be bought over the counter from a pharmacist. It is thought that this reduced sales over the Internet and was safer as males could be referred for medical advice if appropriate.
Coenzyme Q (CoQ) is a quinone and an electron carrier in the mitochondrial electron transport chain (ETC) of eukaryotes and many bacteria. The other name for CoQ is ubiquinone which was assigned by the IUPAC-IUB Commission on Biochemical Nomenclature in 1975 due to its ubiquitous presence from bacteria to humans. In humans the isoprene side chain has ten isoprene units, hence the abbreviation CoQ10. Coenzyme Q is a coenzyme family that is ubiquitous in animals and many Pseudomonadota, a group of gram-negative bacteria. The fact that the coenzyme is ubiquitous gives the origin of its other name, ubiquinone. In humans, the most common form of coenzyme Q is coenzyme Q10, also called CoQ10 () or ubiquinone-10. Coenzyme Q10 is a 1,4-benzoquinone, in which "Q" refers to the quinone chemical group and "10" refers to the number of isoprenyl chemical subunits (shown enclosed in brackets in the diagram) in its tail. In natural ubiquinones, there are from six to ten subunits in the tail, with humans having a tail of 10 isoprene units (50 carbon atoms) connected to its benzoquinone "head". This family of fat-soluble substances is present in all respiring eukaryotic cells, primarily in the mitochondria. Ninety-five percent of the human body's energy is generated this way. Organs with the highest energy requirements—such as the heart, liver, and kidney—have the highest CoQ10 concentrations. There are three redox states of CoQ: fully oxidized (ubiquinone), semiquinone (ubisemiquinone), and fully reduced (ubiquinol).
G-protein-coupled receptor kinase 7 (EC 2.7.11.14, GRK7, cone opsin kinase, iodopsin kinase) is a serine/threonine-specific protein kinase involved in phototransduction. This enzyme catalyses the phosphorylation of cone (color) photopsins in retinal cones during high acuity color vision primarily in the fovea.
=== Anatomical defects === Anatomical or functional defects of the seminal tract may cause flow obstruction of seminal pathways. This can be observed in people with genetic mutations (specifically the CFTR gene) or ejaculatory duct obstruction(s) such as prostate or seminal vesicle cysts. Mutations of the CFTR gene on chromosome 7 can cause an overproduction of thick, sticky mucus in organs with mucous glands, contribute to infertility through clogging the spermatic duct with mucus, and cause congenital bilateral absence of the vas deferens. Examples of anatomical defects include:
Sources: en.wikipedia.org
Its legal status depends on the country and intended use. It is not an approved medicine in major jurisdictions. In sport, it is prohibited by anti-doping rules.
Laboratories typically use LC-MS/MS to detect SR9009 and related compounds in urine or blood. The method is sensitive but depends on sample collection timing. Confirmatory analysis follows quality-control procedures.
Solid material is generally kept cold, dry, and protected from light. Solutions are often stored in sealed containers at low temperature. Stability beyond recommended periods is not well documented.
SR9009 is a synthetic research compound that binds and modulates the nuclear receptors REV-ERBα and REV-ERBβ. It is used in laboratory studies of circadian biology and metabolism, not as an approved medicine. It is also known by the informal name Stenabolic.